PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.29827s0236.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 332aa    MW: 36484.4 Da    PI: 5.3715
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.29827s0236.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.2e-18221255135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Bostr.29827s0236.1.p 221 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 255
                           99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.8E-791309IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.635215251IPR000679Zinc finger, GATA-type
SMARTSM004018.7E-18215265IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-16217279No hitNo description
Gene3DG3DSA:3.30.50.102.2E-14219253IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.54E-15220267No hitNo description
PfamPF003201.2E-15221255IPR000679Zinc finger, GATA-type
PROSITE patternPS003440221246IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEDEAHECFH TADHFAVDDL LVDFSNDDDE EKDVVADSTT TTTLTDSSNV SAVDLPNFSG  60
DVQDGTSFSG DLCVPCDDLA DELEWLSNIV DESFSPEDVQ KLQLISGFKI RPDPKSESGS  120
SGNPNTSSPI FTTDVSVPAK ARSKRSRAAA CNWASRGLLI ETVYDNPFTG ETILSSHNLS  180
PPTSPPPPMA QLGKKQAIDG GYRRKKDVFS PESGGAEERR CLHCATDKTP QWRTGPMGPK  240
TLCNACGVRY KSGRLVPEYR PAASPTFMLT KHSNSHRKVM ELRRQKEMSR AHHEFVHHHH  300
GTDTAMIFDV SSEGDDYLIH HKVGPDLRQL I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937580.0AB493758.1 Arabidopsis thaliana At5g25830 mRNA for hypothetical protein, partial cds, clone: RAAt5g25830.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421443.10.0PREDICTED: GATA transcription factor 12
SwissprotP697810.0GAT12_ARATH; GATA transcription factor 12
TrEMBLC0SVQ50.0C0SVQ5_ARATH; Putative uncharacterized protein At5g25830 (Fragment)
STRINGAT5G25830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-159GATA transcription factor 12